PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g15581.3.p
Common NameBRADI_1g15581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 390aa    MW: 41332.1 Da    PI: 6.5191
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g15581.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.2e-155198148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+ Ed  l + v q+G g+W+++ r+ g+ R++k+c++rw ++l
  Bradi1g15581.3.p 51 KGPWTAAEDTMLMNHVLQHGEGNWNAVQRMSGLLRCGKSCRLRWTNHL 98
                      79******************************99***********996 PP

2Myb_DNA-binding513.2e-16104147146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g+++++E++l++++++qlG++ W++ a++++ gRt++++k++w++
  Bradi1g15581.3.p 104 KGSFSPQEELLIAQLHAQLGNK-WARMASHLP-GRTDNEIKNYWNT 147
                       799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8574698IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.7E-2148101IPR009057Homeodomain-like
SuperFamilySSF466891.5E-2849145IPR009057Homeodomain-like
SMARTSM007172.3E-1250100IPR001005SANT/Myb domain
PfamPF002494.0E-135198IPR001005SANT/Myb domain
CDDcd001671.15E-95398No hitNo description
PROSITE profilePS5129422.33299153IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-24102152IPR009057Homeodomain-like
SMARTSM007173.8E-15103151IPR001005SANT/Myb domain
PfamPF002493.6E-15104147IPR001005SANT/Myb domain
CDDcd001676.85E-11106147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MPMDQGKSSD MVAAPASPEE ENAAATGDSS DEEAPQNQMD NEQAPAAALK KGPWTAAEDT  60
MLMNHVLQHG EGNWNAVQRM SGLLRCGKSC RLRWTNHLRP NLKKGSFSPQ EELLIAQLHA  120
QLGNKWARMA SHLPGRTDNE IKNYWNTRCK RRQRAGLPVY PPEVQLQLAT AAKRCRYDDF  180
SGPLSSSSPQ ESGSSGNVLS LGLGAPDAAA GSYTSARPAA LDLAMGTRPV QFLNAPTMPF  240
SAPSTPWSTT PPFQRNARYL KLSSAPVSPT GAPPVHPVTP ELSLGGLPGT ARFPPLSPVP  300
GAARVELPSS QLRPAMQQPT PAPGGQQAAS ATAGVPQYQQ NGTSYEEILQ GLNDAIKPPE  360
NGSSVDANGQ QQEEADGVSE ENKMATSNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-284915225127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0425371e-116BT042537.1 Zea mays full-length cDNA clone ZM_BFb0325G13 mRNA, complete cds.
GenBankKJ7275321e-116KJ727532.1 Zea mays clone pUT5392 MYB transcription factor (MYB129) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014751997.10.0PREDICTED: protein rough sheath 2-like
TrEMBLA0A0Q3GU000.0A0A0Q3GU00_BRADI; Uncharacterized protein
STRINGBRADI1G15580.11e-128(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.28e-66myb domain protein 101